Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW254797.1 | 5prime_partial | 152 | 488-30(-) |
Amino Acid sequence : | |||
PSMSWRVYRWNSPRSQGTVSPNTAFLFTVMLHRSQSFFNFVSSQSKRSKIPQNQMVFSSTSDKIVPFAHQIVSKRNSIRPHLLCIRLEARGHGLFQGHCKSSNLVIMGPALKGGEDSKVD LVLEIVDCILRLPLLRWLRPLSVEDHPSPWTP* | |||
Physicochemical properties | |||
Number of amino acids: | 152 | ||
Molecular weight: | 13,900.909 | ||
Theoretical pI: | 10.045 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 12950 | ||
Instability index: | 36.816 | ||
aromaticity | 0.086 | ||
GRAVY | -0.376 | ||
Secondary Structure Fraction | |||
Helix | 0.273 | ||
turn | 0.258 | ||
sheet | 0.273 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW254797.1 | 5prime_partial | 128 | 3-389(+) |
Amino Acid sequence : | |||
ARATTTHKSLRGPRAGMIFYRKGPKPPKKGQPEDAVYDFEDKINFAVFPSLQGGPHNHQIGALAVALKQAMAPGFKAYAKQVRANAVALGNYLMSKGYNLVTGGTENHLVLWDLRPLGLT GNKVEKTL* | |||
Physicochemical properties | |||
Number of amino acids: | 128 | ||
Molecular weight: | 13,900.909 | ||
Theoretical pI: | 10.045 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 12950 | ||
Instability index: | 36.816 | ||
aromaticity | 0.086 | ||
GRAVY | -0.376 | ||
Secondary Structure Fraction | |||
Helix | 0.273 | ||
turn | 0.258 | ||
sheet | 0.273 |