| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW254799.1 | internal | 157 | 3-473(+) |
Amino Acid sequence : | |||
| TTEGIIRCGGAAYALLGLLLLSSVSRISALSVTVNDVECIYEYVLYEGDSVSGNFVVVDHDIFWSSDHPGIDFTVTSPAGNTVHTLKGTSGDKFEFKAPRSGMYKFCFHNPYSTPETVSF YIHVGHIPTEHDLAKDEHLDPINVKLAELRKALESVL | |||
Physicochemical properties | |||
| Number of amino acids: | 157 | ||
| Molecular weight: | 17,221.216 | ||
| Theoretical pI: | 5.204 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15930 16055 | ||
| Instability index: | 28.141 | ||
| aromaticity | 0.102 | ||
| GRAVY | 0.028 | ||
Secondary Structure Fraction | |||
| Helix | 0.350 | ||
| turn | 0.248 | ||
| sheet | 0.223 | ||