| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW254801.1 | 3prime_partial | 169 | 38-544(+) |
Amino Acid sequence : | |||
| MGVNVPRIKLGSQGLEVSKQGLGCMGMSAFYGPPKPDSDMIKLIHHAIDSGVTFLDTSDMYGPHTNEILIGKALKGGMREKVQLATKFGIIMGVGKSDIRGDPAYVRSSCESSLKRLDVD CIHLYYVHRIDTSVPIEITMGELKKLVEERKIKYSASQRPSFTIKKAHA | |||
Physicochemical properties | |||
| Number of amino acids: | 169 | ||
| Molecular weight: | 18,580.490 | ||
| Theoretical pI: | 9.219 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8940 9065 | ||
| Instability index: | 34.785 | ||
| aromaticity | 0.059 | ||
| GRAVY | -0.204 | ||
Secondary Structure Fraction | |||
| Helix | 0.290 | ||
| turn | 0.249 | ||
| sheet | 0.219 | ||