| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW254805.1 | internal | 187 | 3-563(+) |
Amino Acid sequence : | |||
| EIEVDMVMNKQIVLNNYINGSLKQSDLALRTSTICMEIPNGCNGAILVKNLYLSVNPYLILRMGKLDIPQFDSILPGSTIVSYGVSKVLDSTHPSYEKGELIWGSQAGWEEYTLIQNPYN LFKIQDKDVPLSYYVGIPRMPGMTAYAGFFEICSPKKSETVFVTAAAGSVGQLVGPLQRCLGAMLLE | |||
Physicochemical properties | |||
| Number of amino acids: | 187 | ||
| Molecular weight: | 20,592.684 | ||
| Theoretical pI: | 5.219 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 25900 26150 | ||
| Instability index: | 34.565 | ||
| aromaticity | 0.091 | ||
| GRAVY | 0.110 | ||
Secondary Structure Fraction | |||
| Helix | 0.358 | ||
| turn | 0.278 | ||
| sheet | 0.251 | ||