Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW254811.1 | 5prime_partial | 141 | 1-426(+) |
Amino Acid sequence : | |||
RHELGHFYLTNLLLEKMKETAKATGVEGRIVNLSSVAHIHTYTGGIRFQNLNNKSGYDDKRAYGQSKLANILHAKELSRRFNGEGVNITANAVHPGLIMNNLFQFSGIWIKKVFKFFTFN LWKNVSQGSSYNIATLHCTRT* | |||
Physicochemical properties | |||
Number of amino acids: | 141 | ||
Molecular weight: | 15,987.091 | ||
Theoretical pI: | 10.003 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18450 18450 | ||
Instability index: | 41.111 | ||
aromaticity | 0.113 | ||
GRAVY | -0.326 | ||
Secondary Structure Fraction | |||
Helix | 0.326 | ||
turn | 0.255 | ||
sheet | 0.220 |