| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW254817.1 | internal | 197 | 2-592(+) |
Amino Acid sequence : | |||
| THLTMGRRPARCYRQIKNKPYPKSRFCRGVPDPKIRIYDVGMKRKGVDEFPFCVHLVSWEKENVSSEALEAARIACNKYMTKFAGKDAFHLRVRVHPFHVLRINKMLSCAGADRLQTGMR GAFGKPQGVCARVAIGQVLLSVRCKDNNSQHAQEALRRAKFKFPGRQKIIVSRKWGFTKFNRSDYVRWKSENRIQPD | |||
Physicochemical properties | |||
| Number of amino acids: | 197 | ||
| Molecular weight: | 22,794.375 | ||
| Theoretical pI: | 10.523 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23950 24325 | ||
| Instability index: | 45.650 | ||
| aromaticity | 0.096 | ||
| GRAVY | -0.614 | ||
Secondary Structure Fraction | |||
| Helix | 0.269 | ||
| turn | 0.208 | ||
| sheet | 0.188 | ||