Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW254817.1 | internal | 197 | 2-592(+) |
Amino Acid sequence : | |||
THLTMGRRPARCYRQIKNKPYPKSRFCRGVPDPKIRIYDVGMKRKGVDEFPFCVHLVSWEKENVSSEALEAARIACNKYMTKFAGKDAFHLRVRVHPFHVLRINKMLSCAGADRLQTGMR GAFGKPQGVCARVAIGQVLLSVRCKDNNSQHAQEALRRAKFKFPGRQKIIVSRKWGFTKFNRSDYVRWKSENRIQPD | |||
Physicochemical properties | |||
Number of amino acids: | 197 | ||
Molecular weight: | 22,794.375 | ||
Theoretical pI: | 10.523 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23950 24325 | ||
Instability index: | 45.650 | ||
aromaticity | 0.096 | ||
GRAVY | -0.614 | ||
Secondary Structure Fraction | |||
Helix | 0.269 | ||
turn | 0.208 | ||
sheet | 0.188 |