Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW254819.1 | internal | 167 | 1-501(+) |
Amino Acid sequence : | |||
RHESARAGNYNPSRWDVDFVQSLHSDYMEDKHAIRASELVTLVKMELEKETDQIRQLELIDDLQRMGLSDHFQNEFKEILSSIHLDRHYYKNPFPKEERDLYSTSLAFRLLREHGFQVAQ EVFDSFKNEEGEFKESLSDDTRGMLQMYEASFLLTEGETTLESAREF | |||
Physicochemical properties | |||
Number of amino acids: | 167 | ||
Molecular weight: | 19,776.661 | ||
Theoretical pI: | 4.824 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14440 14440 | ||
Instability index: | 45.118 | ||
aromaticity | 0.108 | ||
GRAVY | -0.801 | ||
Secondary Structure Fraction | |||
Helix | 0.287 | ||
turn | 0.174 | ||
sheet | 0.323 |