| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW254819.1 | internal | 167 | 1-501(+) |
Amino Acid sequence : | |||
| RHESARAGNYNPSRWDVDFVQSLHSDYMEDKHAIRASELVTLVKMELEKETDQIRQLELIDDLQRMGLSDHFQNEFKEILSSIHLDRHYYKNPFPKEERDLYSTSLAFRLLREHGFQVAQ EVFDSFKNEEGEFKESLSDDTRGMLQMYEASFLLTEGETTLESAREF | |||
Physicochemical properties | |||
| Number of amino acids: | 167 | ||
| Molecular weight: | 19,776.661 | ||
| Theoretical pI: | 4.824 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14440 14440 | ||
| Instability index: | 45.118 | ||
| aromaticity | 0.108 | ||
| GRAVY | -0.801 | ||
Secondary Structure Fraction | |||
| Helix | 0.287 | ||
| turn | 0.174 | ||
| sheet | 0.323 | ||