Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW254820.1 | 5prime_partial | 118 | 2-358(+) |
Amino Acid sequence : | |||
EGAVNPRVKTMADAQNCLLPMGITSENVAHRFGVTRMEQDQAAVDSHKKAAAATASGKFKDEIIPVKTKIVDPKSGDEKPVTISVDDGIRPGTTVAGLAKLKPVFKKDGSPLLGIPLQ* | |||
Physicochemical properties | |||
Number of amino acids: | 118 | ||
Molecular weight: | 12,432.215 | ||
Theoretical pI: | 9.107 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
Instability index: | 16.947 | ||
aromaticity | 0.025 | ||
GRAVY | -0.281 | ||
Secondary Structure Fraction | |||
Helix | 0.237 | ||
turn | 0.237 | ||
sheet | 0.237 |