| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW254824.1 | internal | 198 | 3-596(+) |
Amino Acid sequence : | |||
| AAAAAAGYMDAVSEWGNTPLAAVDPEIHDLIEKEKRRQCRGIELIASENFTSFAVIEALGSALTNKYSEGMPGNRYYGGNEYIDQIENLTRSRALQAYRLDPTKWGVNVQPYSGSPANFA AYTGGAQPARTHHGPRSALRGPSDPRVLHLRGEEDLPTSIYFESLPYKVNSTNGLSITINWKRKGWISGPTDYLPWGC | |||
Physicochemical properties | |||
| Number of amino acids: | 198 | ||
| Molecular weight: | 21,763.017 | ||
| Theoretical pI: | 6.493 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 43890 44015 | ||
| Instability index: | 44.832 | ||
| aromaticity | 0.101 | ||
| GRAVY | -0.520 | ||
Secondary Structure Fraction | |||
| Helix | 0.268 | ||
| turn | 0.298 | ||
| sheet | 0.258 | ||