Acc_NO	ORF type	length	start-end position (strand +/-)
>AW254824.1	internal	198	3-596(+)
Amino Acid sequence :
AAAAAAGYMDAVSEWGNTPLAAVDPEIHDLIEKEKRRQCRGIELIASENFTSFAVIEALGSALTNKYSEGMPGNRYYGGNEYIDQIENLTRSRALQAYRLDPTKWGVNVQPYSGSPANFA AYTGGAQPARTHHGPRSALRGPSDPRVLHLRGEEDLPTSIYFESLPYKVNSTNGLSITINWKRKGWISGPTDYLPWGC
Physicochemical properties
Number of amino acids:		198
Molecular weight:		21,763.017
Theoretical pI:		6.493
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		43890 44015
Instability index:		44.832
aromaticity		0.101
GRAVY		-0.520
Secondary Structure Fraction
Helix		0.268
turn		0.298
sheet		0.258