Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW254826.1 | 5prime_partial | 141 | 1-426(+) |
Amino Acid sequence : | |||
KQGARFAKWRTVVSIPCGPSALAVKEAAWGLACYAAISQDNGLVPIVEPEILLDGDHSIDRTLEVAERVWSEVFYYLAENNVVFEGILLKPSMVTPGAEHKEKGAPETVAKYTLTMLNRS VSPAVPGIMFLSRGQSEAEAT* | |||
Physicochemical properties | |||
Number of amino acids: | 141 | ||
Molecular weight: | 13,764.166 | ||
Theoretical pI: | 7.874 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14230 | ||
Instability index: | 44.066 | ||
aromaticity | 0.131 | ||
GRAVY | -0.420 | ||
Secondary Structure Fraction | |||
Helix | 0.303 | ||
turn | 0.328 | ||
sheet | 0.131 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW254826.1 | 5prime_partial | 122 | 459-91(-) |
Amino Acid sequence : | |||
HGSDFDSSRSDSGRLRFRLSSGQKHDSGNCRRHTPVEHGEGIFGNSFWSAFLFVFSSWCYHARFEKNPFEDYIVLCQVVENFGPDSLCHFKCPVNGVVPIEKNLGFHNGHKAVVLRNSSV TS* | |||
Physicochemical properties | |||
Number of amino acids: | 122 | ||
Molecular weight: | 13,764.166 | ||
Theoretical pI: | 7.874 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14230 | ||
Instability index: | 44.066 | ||
aromaticity | 0.131 | ||
GRAVY | -0.420 | ||
Secondary Structure Fraction | |||
Helix | 0.303 | ||
turn | 0.328 | ||
sheet | 0.131 |