| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW254826.1 | 5prime_partial | 141 | 1-426(+) |
Amino Acid sequence : | |||
| KQGARFAKWRTVVSIPCGPSALAVKEAAWGLACYAAISQDNGLVPIVEPEILLDGDHSIDRTLEVAERVWSEVFYYLAENNVVFEGILLKPSMVTPGAEHKEKGAPETVAKYTLTMLNRS VSPAVPGIMFLSRGQSEAEAT* | |||
Physicochemical properties | |||
| Number of amino acids: | 141 | ||
| Molecular weight: | 13,764.166 | ||
| Theoretical pI: | 7.874 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14230 | ||
| Instability index: | 44.066 | ||
| aromaticity | 0.131 | ||
| GRAVY | -0.420 | ||
Secondary Structure Fraction | |||
| Helix | 0.303 | ||
| turn | 0.328 | ||
| sheet | 0.131 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW254826.1 | 5prime_partial | 122 | 459-91(-) |
Amino Acid sequence : | |||
| HGSDFDSSRSDSGRLRFRLSSGQKHDSGNCRRHTPVEHGEGIFGNSFWSAFLFVFSSWCYHARFEKNPFEDYIVLCQVVENFGPDSLCHFKCPVNGVVPIEKNLGFHNGHKAVVLRNSSV TS* | |||
Physicochemical properties | |||
| Number of amino acids: | 122 | ||
| Molecular weight: | 13,764.166 | ||
| Theoretical pI: | 7.874 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14230 | ||
| Instability index: | 44.066 | ||
| aromaticity | 0.131 | ||
| GRAVY | -0.420 | ||
Secondary Structure Fraction | |||
| Helix | 0.303 | ||
| turn | 0.328 | ||
| sheet | 0.131 | ||