Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW254836.1 | internal | 142 | 2-427(+) |
Amino Acid sequence : | |||
LNIVQAHFQQELKESFRWWRNTGFVEKLPFARDRLVECYFWNTGIIEPRQHASARIMMGKVNALITVIDDIYDVYGTLEELEHFTDLIRRWDIDSIDQLPDYMQLCFLALNNFVDETSYD VMKEKGVNVIPYLRQSWVDLAD | |||
Physicochemical properties | |||
Number of amino acids: | 142 | ||
Molecular weight: | 16,910.067 | ||
Theoretical pI: | 4.723 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 36440 36565 | ||
Instability index: | 41.998 | ||
aromaticity | 0.134 | ||
GRAVY | -0.222 | ||
Secondary Structure Fraction | |||
Helix | 0.387 | ||
turn | 0.148 | ||
sheet | 0.246 |