Acc_NO	ORF type	length	start-end position (strand +/-)
>AW254840.1	5prime_partial	111	2-337(+)
Amino Acid sequence :
KANGEMIEKFEGAKDCVVTNYYGPKRLTQALIPLLQLSPSPRIVNVSSSFGSLLLLWNEWAKGVLGDQDRLTQERVDEVVEVFLPDIKEGGLEESQWAPHFAGERVSKGAF*
Physicochemical properties
Number of amino acids:		111
Molecular weight:		12,346.889
Theoretical pI:		4.976
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		19480 19480
Instability index:		30.810
aromaticity		0.090
GRAVY		-0.248
Secondary Structure Fraction
Helix		0.333
turn		0.252
sheet		0.288