| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW254843.1 | internal | 149 | 1-447(+) |
Amino Acid sequence : | |||
| FWNTGIIEPRQHASARIMMGKVNALITVIDDIYDVYGTLEELEHFTDLIRRWDIDSIDQLPDYMQLCFLALNNFVDETSYDVMKEKGVNVIPYLRQSWVDLADKYMVEARWFYGGHKPSL EEYLENSWMSISGPCMLTHIFFRVTDSFT | |||
Physicochemical properties | |||
| Number of amino acids: | 149 | ||
| Molecular weight: | 17,547.805 | ||
| Theoretical pI: | 4.593 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 39420 39545 | ||
| Instability index: | 51.207 | ||
| aromaticity | 0.141 | ||
| GRAVY | -0.140 | ||
Secondary Structure Fraction | |||
| Helix | 0.376 | ||
| turn | 0.181 | ||
| sheet | 0.242 | ||