Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW254844.1 | 5prime_partial | 129 | 3-392(+) |
Amino Acid sequence : | |||
ARAMAEVQRYALVTGANKGIGFEICRQLAEKGIIVILTSRNEKRGLEARQKLLKELNVSENRLVFHQLDVTDLASVAAVAVFIKSKFGKLDILVNNAGVIGVKMVGDVSVFNEYIEADFK ALQALQSWC* | |||
Physicochemical properties | |||
Number of amino acids: | 129 | ||
Molecular weight: | 14,194.406 | ||
Theoretical pI: | 8.983 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
Instability index: | 29.133 | ||
aromaticity | 0.070 | ||
GRAVY | 0.210 | ||
Secondary Structure Fraction | |||
Helix | 0.364 | ||
turn | 0.171 | ||
sheet | 0.310 |