| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW254854.1 | internal | 187 | 1-561(+) |
Amino Acid sequence : | |||
| LALAEAWNHGFGFIKTSIVKTAVELEIPDILESRGAPISIPELAAAVDCSADRLFRVMRFLAYHGIFKRTKPPPESTGSSSVYYAQTPVSRRLTRENLGPFVLLQGTMKEPSGCVTAETL RTSKRPGVIYESDSDRLYEDPVFHMKVFRDAMASHARMTTAVVIENYGEGFRGVGSLVDVGGSYGMA | |||
Physicochemical properties | |||
| Number of amino acids: | 187 | ||
| Molecular weight: | 14,848.570 | ||
| Theoretical pI: | 10.596 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11000 | ||
| Instability index: | 50.683 | ||
| aromaticity | 0.030 | ||
| GRAVY | -0.647 | ||
Secondary Structure Fraction | |||
| Helix | 0.241 | ||
| turn | 0.248 | ||
| sheet | 0.256 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW254854.1 | 5prime_partial | 133 | 561-160(-) |
Amino Acid sequence : | |||
| SHSVRTADIHQRPDSSETLAVVLDHHRRRHPSMARHSIPKNLHMENWILVQAVRVALIDNAGSFARPQGLRRHTPGRLFHGALKQHEGPQILPSEAARDRGLSVVDRTAPGRLGWRLGSL EDAVIGKEPHDSE* | |||
Physicochemical properties | |||
| Number of amino acids: | 133 | ||
| Molecular weight: | 14,848.570 | ||
| Theoretical pI: | 10.596 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11000 | ||
| Instability index: | 50.683 | ||
| aromaticity | 0.030 | ||
| GRAVY | -0.647 | ||
Secondary Structure Fraction | |||
| Helix | 0.241 | ||
| turn | 0.248 | ||
| sheet | 0.256 | ||