| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW254857.1 | internal | 207 | 1-621(+) |
Amino Acid sequence : | |||
| EKQAAMANVQRYALVTGANKGIGFEICRQLAEKGIIVILTARNEKRGIEAHQRLLKELNISKNHLVFHQLDVTDPASIAAVAVFIKSTFGKLDILVNNAGVSGVEMVGDVSVFNEYIEAD FNALQALEAGAKEEPPFKPKANGEMIEKFEGAKDCVETNYYGPKETNTSPHSSLTLSPSPRIATFSSSFGNYCFYGTHGKGNAGGQG | |||
Physicochemical properties | |||
| Number of amino acids: | 207 | ||
| Molecular weight: | 13,037.840 | ||
| Theoretical pI: | 5.447 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12865 | ||
| Instability index: | 54.396 | ||
| aromaticity | 0.133 | ||
| GRAVY | 0.234 | ||
Secondary Structure Fraction | |||
| Helix | 0.381 | ||
| turn | 0.239 | ||
| sheet | 0.221 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW254857.1 | complete | 113 | 513-172(-) |
Amino Acid sequence : | |||
| MRACVSLFWTIVVCFDAIFGSFEFFDHFSICFGLKWRLFLCTSFECLKGVEVSLNILVEHRNISNHLYSANSGIIHQNIELSECRFDEDGNSSDASRIGNIELMKNQMIFRNV* | |||
Physicochemical properties | |||
| Number of amino acids: | 113 | ||
| Molecular weight: | 13,037.840 | ||
| Theoretical pI: | 5.447 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12865 | ||
| Instability index: | 54.396 | ||
| aromaticity | 0.133 | ||
| GRAVY | 0.234 | ||
Secondary Structure Fraction | |||
| Helix | 0.381 | ||
| turn | 0.239 | ||
| sheet | 0.221 | ||