| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW254861.1 | 5prime_partial | 128 | 2-388(+) |
Amino Acid sequence : | |||
| AIKKTIKECDDAAAAGEEKLCATSLESMVDFITGILRREVSAVSTASDKADRETYRVAAVNKLPTENAVVVCHQHDYPYAVYYCHKTKTTAASGVSLCQGKRGQCGCGGCIPYGHRGVDP SSPWRFTC* | |||
Physicochemical properties | |||
| Number of amino acids: | 128 | ||
| Molecular weight: | 13,793.514 | ||
| Theoretical pI: | 8.125 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14440 14940 | ||
| Instability index: | 36.316 | ||
| aromaticity | 0.070 | ||
| GRAVY | -0.282 | ||
Secondary Structure Fraction | |||
| Helix | 0.234 | ||
| turn | 0.203 | ||
| sheet | 0.219 | ||