| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW254869.1 | 5prime_partial | 182 | 1-549(+) |
Amino Acid sequence : | |||
| LCQVSKMAIQIWEALKESITAYTGLSPAAFFTAIAVALAFYQLLSALLCFSDDGPVNHGSRKLEEEEEEVKPLPPPVQIGDVTDEELKQYDGSDPTKPLLMAIKAQIYDVSQSRMFYGPG GPYALFAGKDASPALAKMSFDEKDLNGDLTGLSHFELEALKDWEYNFMGQYVKVGMSNPCSS* | |||
Physicochemical properties | |||
| Number of amino acids: | 182 | ||
| Molecular weight: | 19,958.465 | ||
| Theoretical pI: | 4.484 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22920 23045 | ||
| Instability index: | 48.312 | ||
| aromaticity | 0.104 | ||
| GRAVY | -0.144 | ||
Secondary Structure Fraction | |||
| Helix | 0.302 | ||
| turn | 0.242 | ||
| sheet | 0.319 | ||