| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW254870.1 | internal | 148 | 1-444(+) |
Amino Acid sequence : | |||
| GFIKTSIVKTAVELEIPDILESRGAPVSIPELATAVDCSADRIYRVMRFLAYHGIFKRTKPPPESTEGGSVYYAQTPVSRRLTRENLGPFVLLQGTMREPSGCVTAETLRTSKRPGVVNE NESDHLYEDPVFSMKVFRDAMASHARMT | |||
Physicochemical properties | |||
| Number of amino acids: | 148 | ||
| Molecular weight: | 12,575.073 | ||
| Theoretical pI: | 10.667 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12490 | ||
| Instability index: | 46.933 | ||
| aromaticity | 0.034 | ||
| GRAVY | -0.377 | ||
Secondary Structure Fraction | |||
| Helix | 0.276 | ||
| turn | 0.293 | ||
| sheet | 0.250 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW254870.1 | 5prime_partial | 116 | 444-94(-) |
Amino Acid sequence : | |||
| RHPSMARHSIPKNLHTENRILVQVVRLVLIDNAGSFARPQGLRRHTPGWLSHGALKQHEGPQILPSEAARDRGLSVVNRTALGRLGWRLGSLEDAVIGQEPHDSVYAVSGAVDSGG* | |||
Physicochemical properties | |||
| Number of amino acids: | 116 | ||
| Molecular weight: | 12,575.073 | ||
| Theoretical pI: | 10.667 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12490 | ||
| Instability index: | 46.933 | ||
| aromaticity | 0.034 | ||
| GRAVY | -0.377 | ||
Secondary Structure Fraction | |||
| Helix | 0.276 | ||
| turn | 0.293 | ||
| sheet | 0.250 | ||