Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW254874.1 | 5prime_partial | 166 | 3-503(+) |
Amino Acid sequence : | |||
NGISSKQELLEAQAHVWNHIYSYINSMSLKCAIQLGIPDAIHKHGNPITLSQLADALNINKAKSHGLFRLMRILVHSGFFDKVKVKVKVEGEDEEEEEDAYSLTPASRLLLKSEPLNVGP FALAMFGTRLHRDMAPSERMVPQPCCGCVRYPIRDDIPRVPVGEES* | |||
Physicochemical properties | |||
Number of amino acids: | 166 | ||
Molecular weight: | 14,288.128 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
Instability index: | 110.174 | ||
aromaticity | 0.050 | ||
GRAVY | -1.245 | ||
Secondary Structure Fraction | |||
Helix | 0.190 | ||
turn | 0.273 | ||
sheet | 0.174 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW254874.1 | complete | 121 | 50-415(+) |
Amino Acid sequence : | |||
MEPHLQLHKLHVLKMRDSIRHTRRHPQTRQPYNAFPTSRCPQHQQGQVPRPLSPNADSSPLRILRQSQSQGQGRRRGRRRRRRCLFPNSSFAPLVEERTLERGAFRARHVWNPSTPRHGT I* | |||
Physicochemical properties | |||
Number of amino acids: | 121 | ||
Molecular weight: | 14,288.128 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
Instability index: | 110.174 | ||
aromaticity | 0.050 | ||
GRAVY | -1.245 | ||
Secondary Structure Fraction | |||
Helix | 0.190 | ||
turn | 0.273 | ||
sheet | 0.174 |