| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW254874.1 | 5prime_partial | 166 | 3-503(+) |
Amino Acid sequence : | |||
| NGISSKQELLEAQAHVWNHIYSYINSMSLKCAIQLGIPDAIHKHGNPITLSQLADALNINKAKSHGLFRLMRILVHSGFFDKVKVKVKVEGEDEEEEEDAYSLTPASRLLLKSEPLNVGP FALAMFGTRLHRDMAPSERMVPQPCCGCVRYPIRDDIPRVPVGEES* | |||
Physicochemical properties | |||
| Number of amino acids: | 166 | ||
| Molecular weight: | 14,288.128 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
| Instability index: | 110.174 | ||
| aromaticity | 0.050 | ||
| GRAVY | -1.245 | ||
Secondary Structure Fraction | |||
| Helix | 0.190 | ||
| turn | 0.273 | ||
| sheet | 0.174 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW254874.1 | complete | 121 | 50-415(+) |
Amino Acid sequence : | |||
| MEPHLQLHKLHVLKMRDSIRHTRRHPQTRQPYNAFPTSRCPQHQQGQVPRPLSPNADSSPLRILRQSQSQGQGRRRGRRRRRRCLFPNSSFAPLVEERTLERGAFRARHVWNPSTPRHGT I* | |||
Physicochemical properties | |||
| Number of amino acids: | 121 | ||
| Molecular weight: | 14,288.128 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
| Instability index: | 110.174 | ||
| aromaticity | 0.050 | ||
| GRAVY | -1.245 | ||
Secondary Structure Fraction | |||
| Helix | 0.190 | ||
| turn | 0.273 | ||
| sheet | 0.174 | ||