| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW254876.1 | internal | 162 | 2-487(+) |
Amino Acid sequence : | |||
| LNIVQAHFQQELKESFRWWRNTGFVEKLPFARDRLVECYFWNTGIIEPRQHASARIMMGKVNALITVIDDIYDVYGTLEELEHFTDLIRRWDIDSIDQLPDYMQLCFLALNNFVDETSYD VMKEKGVNVIPYLRQSWVDLADKYMVEARWFYGGHKPSLEEY | |||
Physicochemical properties | |||
| Number of amino acids: | 162 | ||
| Molecular weight: | 19,382.840 | ||
| Theoretical pI: | 4.874 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 46410 46535 | ||
| Instability index: | 50.219 | ||
| aromaticity | 0.148 | ||
| GRAVY | -0.315 | ||
Secondary Structure Fraction | |||
| Helix | 0.383 | ||
| turn | 0.154 | ||
| sheet | 0.253 | ||