| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW254879.1 | internal | 184 | 3-554(+) |
Amino Acid sequence : | |||
| KMAQILASHLIKPSSPTPNTFKKHKLSVLDQISPPAYLTLIFFYQDLESNQHEEISRRLKQSLSEILTIFYPLAGTVHRNSFVDCNDRSAEFVEARVHGGLSKFVQNPKMEELEQLLPAD FSSHTENPILSVRISYFDCGGNRSPRLFSPYNWRYLLFWHVHECMGRHLSWGKLLKITPPPSIW | |||
Physicochemical properties | |||
| Number of amino acids: | 184 | ||
| Molecular weight: | 21,295.199 | ||
| Theoretical pI: | 8.786 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30940 31065 | ||
| Instability index: | 64.565 | ||
| aromaticity | 0.114 | ||
| GRAVY | -0.321 | ||
Secondary Structure Fraction | |||
| Helix | 0.337 | ||
| turn | 0.266 | ||
| sheet | 0.234 | ||