Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW254879.1 | internal | 184 | 3-554(+) |
Amino Acid sequence : | |||
KMAQILASHLIKPSSPTPNTFKKHKLSVLDQISPPAYLTLIFFYQDLESNQHEEISRRLKQSLSEILTIFYPLAGTVHRNSFVDCNDRSAEFVEARVHGGLSKFVQNPKMEELEQLLPAD FSSHTENPILSVRISYFDCGGNRSPRLFSPYNWRYLLFWHVHECMGRHLSWGKLLKITPPPSIW | |||
Physicochemical properties | |||
Number of amino acids: | 184 | ||
Molecular weight: | 21,295.199 | ||
Theoretical pI: | 8.786 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30940 31065 | ||
Instability index: | 64.565 | ||
aromaticity | 0.114 | ||
GRAVY | -0.321 | ||
Secondary Structure Fraction | |||
Helix | 0.337 | ||
turn | 0.266 | ||
sheet | 0.234 |