| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW254881.1 | internal | 166 | 2-499(+) |
Amino Acid sequence : | |||
| LTEMEPRIQKAFKDMEELEKGAIANPDEGRMVGHYWLRDPNLAPKAILTQQIESTLERISDFAEQVISGKIKPPLRDRFTQILSIGIGGSALGPQFVAEALAPDNPPLKIRFIDNTDPAG IDHQIAQLGSELESTLVIVVSKSGGTPETRNGLLEVQKAFREAGLD | |||
Physicochemical properties | |||
| Number of amino acids: | 166 | ||
| Molecular weight: | 18,155.468 | ||
| Theoretical pI: | 4.932 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
| Instability index: | 26.969 | ||
| aromaticity | 0.048 | ||
| GRAVY | -0.296 | ||
Secondary Structure Fraction | |||
| Helix | 0.283 | ||
| turn | 0.241 | ||
| sheet | 0.295 | ||