Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW254881.1 | internal | 166 | 2-499(+) |
Amino Acid sequence : | |||
LTEMEPRIQKAFKDMEELEKGAIANPDEGRMVGHYWLRDPNLAPKAILTQQIESTLERISDFAEQVISGKIKPPLRDRFTQILSIGIGGSALGPQFVAEALAPDNPPLKIRFIDNTDPAG IDHQIAQLGSELESTLVIVVSKSGGTPETRNGLLEVQKAFREAGLD | |||
Physicochemical properties | |||
Number of amino acids: | 166 | ||
Molecular weight: | 18,155.468 | ||
Theoretical pI: | 4.932 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
Instability index: | 26.969 | ||
aromaticity | 0.048 | ||
GRAVY | -0.296 | ||
Secondary Structure Fraction | |||
Helix | 0.283 | ||
turn | 0.241 | ||
sheet | 0.295 |