Acc_NO	ORF type	length	start-end position (strand +/-)
>AW254884.1	internal	160	1-480(+)
Amino Acid sequence :
PIPSKLTTYLQPSHLNSSPKLLSNTKGTSRSRLRVSCSSSQLTTERRSGNYNPSRWDVDFIQTLHSDYKDEKHARRASELVTLVKMELEKETDQIRQLELIDDLQRMGLSDHFQNEFKEI LSSVYLDHGYSRILIQKKKGIYTPHLLHLGSFENMGFKLL
Physicochemical properties
Number of amino acids:		160
Molecular weight:		13,405.387
Theoretical pI:		11.000
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		1490 1490
Instability index:		52.719
aromaticity		0.078
GRAVY		-0.138
Secondary Structure Fraction
Helix		0.365
turn		0.200
sheet		0.226

Acc_NO	ORF type	length	start-end position (strand +/-)
>AW254884.1	complete	115	384-37(-)
Amino Acid sequence :
MVEIYRGQDFFELVLEMIGQPHPLQVINQFKLSNLIRFFLQFHLHQSDQLRSPSRMLLVLIITVERLDKVDIPTRRVVVSGSSFGSELRGGARHTEARSTSTLSVREQFRRRIQV*
Physicochemical properties
Number of amino acids:		115
Molecular weight:		13,405.387
Theoretical pI:		11.000
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		1490 1490
Instability index:		52.719
aromaticity		0.078
GRAVY		-0.138
Secondary Structure Fraction
Helix		0.365
turn		0.200
sheet		0.226