Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW254887.1 | internal | 164 | 3-494(+) |
Amino Acid sequence : | |||
RVQLKRIENKINRQVTFSKRRSGLLKKAREISILCDADVGLIVFSTKGKLFEYATDSCMETILERYERCSYADRQLKEPDLDSPASWTLEHAKLKARAEVLQKNQRHYMGEELDTLSMKE LQSVEHQLDVSLKHIRTRKNQLMNESISELQKKDKALQEQNNFL | |||
Physicochemical properties | |||
Number of amino acids: | 164 | ||
Molecular weight: | 19,224.833 | ||
Theoretical pI: | 9.099 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11585 | ||
Instability index: | 57.147 | ||
aromaticity | 0.055 | ||
GRAVY | -0.772 | ||
Secondary Structure Fraction | |||
Helix | 0.274 | ||
turn | 0.159 | ||
sheet | 0.305 |