| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW254888.1 | internal | 119 | 2-358(+) |
Amino Acid sequence : | |||
| EQFTELIRRWDIDSIDQLPDYMQLCFLALNNFVDETSYDVMKEKGVNVIPYLRQSWVDLADKYMVEARWFYGGHKPSLEEYLENSWQSISGPCMLTHIFFRVTDXFTKETVDSLYKYHD | |||
Physicochemical properties | |||
| Number of amino acids: | 119 | ||
| Molecular weight: | 14,165.820 | ||
| Theoretical pI: | 4.650 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 33920 34045 | ||
| Instability index: | 57.058 | ||
| aromaticity | 0.161 | ||
| GRAVY | -0.420 | ||
Secondary Structure Fraction | |||
| Helix | 0.373 | ||
| turn | 0.169 | ||
| sheet | 0.229 | ||