Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW254888.1 | internal | 119 | 2-358(+) |
Amino Acid sequence : | |||
EQFTELIRRWDIDSIDQLPDYMQLCFLALNNFVDETSYDVMKEKGVNVIPYLRQSWVDLADKYMVEARWFYGGHKPSLEEYLENSWQSISGPCMLTHIFFRVTDXFTKETVDSLYKYHD | |||
Physicochemical properties | |||
Number of amino acids: | 119 | ||
Molecular weight: | 14,165.820 | ||
Theoretical pI: | 4.650 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 33920 34045 | ||
Instability index: | 57.058 | ||
aromaticity | 0.161 | ||
GRAVY | -0.420 | ||
Secondary Structure Fraction | |||
Helix | 0.373 | ||
turn | 0.169 | ||
sheet | 0.229 |