| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW254893.1 | 5prime_partial | 135 | 2-409(+) |
Amino Acid sequence : | |||
| QRYALVTGANKGIGFEICRQLAEKGIIVILTSRNEKRGLEARQKLLKELNVSENRLVFHQLDVTDLASVAAVAVFIKSKFGKLDILVNNAGVSGVEMVGDVSVFNEYIEADFKALQALEA GAKEEPHLSQKPMEK* | |||
Physicochemical properties | |||
| Number of amino acids: | 135 | ||
| Molecular weight: | 14,826.958 | ||
| Theoretical pI: | 6.950 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
| Instability index: | 23.020 | ||
| aromaticity | 0.059 | ||
| GRAVY | -0.045 | ||
Secondary Structure Fraction | |||
| Helix | 0.333 | ||
| turn | 0.193 | ||
| sheet | 0.326 | ||