Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW254893.1 | 5prime_partial | 135 | 2-409(+) |
Amino Acid sequence : | |||
QRYALVTGANKGIGFEICRQLAEKGIIVILTSRNEKRGLEARQKLLKELNVSENRLVFHQLDVTDLASVAAVAVFIKSKFGKLDILVNNAGVSGVEMVGDVSVFNEYIEADFKALQALEA GAKEEPHLSQKPMEK* | |||
Physicochemical properties | |||
Number of amino acids: | 135 | ||
Molecular weight: | 14,826.958 | ||
Theoretical pI: | 6.950 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
Instability index: | 23.020 | ||
aromaticity | 0.059 | ||
GRAVY | -0.045 | ||
Secondary Structure Fraction | |||
Helix | 0.333 | ||
turn | 0.193 | ||
sheet | 0.326 |