| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW254895.1 | internal | 212 | 1-636(+) |
Amino Acid sequence : | |||
| VNFAGMGQNLLKPILRAEGPDPFSFHLYFAHCGTLATASLNKGGMWCVPVSPVNLAVYKPKGTSGTLEFNEAFVSKNHNWLHYMSTCTAYWRGTLTYELRVTYKDRSFAVANLCAFYTTQ MEGLFGFSDKAIGDTGITSVCGECFSVKISVPFVTPTLWLRTIAIFSICKHLAMVHCILVCLLKVLLLLQLWVRAENDFSFERFKILKAEYI | |||
Physicochemical properties | |||
| Number of amino acids: | 212 | ||
| Molecular weight: | 23,805.640 | ||
| Theoretical pI: | 8.715 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 39420 39920 | ||
| Instability index: | 29.819 | ||
| aromaticity | 0.137 | ||
| GRAVY | 0.327 | ||
Secondary Structure Fraction | |||
| Helix | 0.377 | ||
| turn | 0.208 | ||
| sheet | 0.259 | ||