| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW254898.1 | internal | 165 | 3-497(+) |
Amino Acid sequence : | |||
| KQELLEAQAHVWNHIYSYINSMSLKCAIQLGIPDAIHKHGNPITLSQLADALNINKAKSHGLFRLMRILVHSGFFDKVKVKVKVKGEDEEEEEDAYSLTPASRLLLRSEPLSVAPFALAM SDPVYTETWHHLSEWFRNDAVAAFDTKYGMTFPEYAVADDRLNVL | |||
Physicochemical properties | |||
| Number of amino acids: | 165 | ||
| Molecular weight: | 16,790.034 | ||
| Theoretical pI: | 11.599 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3230 | ||
| Instability index: | 70.860 | ||
| aromaticity | 0.041 | ||
| GRAVY | -1.010 | ||
Secondary Structure Fraction | |||
| Helix | 0.190 | ||
| turn | 0.279 | ||
| sheet | 0.184 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW254898.1 | complete | 147 | 35-478(+) |
Amino Acid sequence : | |||
| MEPHLQLHKLHVLKMRDSIRHTRRHPQTRQPYNAFPTSRCPQHQQGQVPRPLSPNADSSPLRILRQGQGQGQGQGRGRRRRGRCLFPNSSFAPLVEERALERGAFRARHVGPRLHGDMAP SERMVPQRCCGCVRYQIRDDIPGVRGG* | |||
Physicochemical properties | |||
| Number of amino acids: | 147 | ||
| Molecular weight: | 16,790.034 | ||
| Theoretical pI: | 11.599 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3230 | ||
| Instability index: | 70.860 | ||
| aromaticity | 0.041 | ||
| GRAVY | -1.010 | ||
Secondary Structure Fraction | |||
| Helix | 0.190 | ||
| turn | 0.279 | ||
| sheet | 0.184 | ||