Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW254898.1 | internal | 165 | 3-497(+) |
Amino Acid sequence : | |||
KQELLEAQAHVWNHIYSYINSMSLKCAIQLGIPDAIHKHGNPITLSQLADALNINKAKSHGLFRLMRILVHSGFFDKVKVKVKVKGEDEEEEEDAYSLTPASRLLLRSEPLSVAPFALAM SDPVYTETWHHLSEWFRNDAVAAFDTKYGMTFPEYAVADDRLNVL | |||
Physicochemical properties | |||
Number of amino acids: | 165 | ||
Molecular weight: | 16,790.034 | ||
Theoretical pI: | 11.599 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3230 | ||
Instability index: | 70.860 | ||
aromaticity | 0.041 | ||
GRAVY | -1.010 | ||
Secondary Structure Fraction | |||
Helix | 0.190 | ||
turn | 0.279 | ||
sheet | 0.184 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW254898.1 | complete | 147 | 35-478(+) |
Amino Acid sequence : | |||
MEPHLQLHKLHVLKMRDSIRHTRRHPQTRQPYNAFPTSRCPQHQQGQVPRPLSPNADSSPLRILRQGQGQGQGQGRGRRRRGRCLFPNSSFAPLVEERALERGAFRARHVGPRLHGDMAP SERMVPQRCCGCVRYQIRDDIPGVRGG* | |||
Physicochemical properties | |||
Number of amino acids: | 147 | ||
Molecular weight: | 16,790.034 | ||
Theoretical pI: | 11.599 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3230 | ||
Instability index: | 70.860 | ||
aromaticity | 0.041 | ||
GRAVY | -1.010 | ||
Secondary Structure Fraction | |||
Helix | 0.190 | ||
turn | 0.279 | ||
sheet | 0.184 |