Acc_NO	ORF type	length	start-end position (strand +/-)
>AW254899.1	internal	160	1-480(+)
Amino Acid sequence :
LGGGDSGSSYKFIAPCLYSASYPNGGAGGEKAMLVFLCVPVSPYESRLIFAFPRNFAAWMDKIIPRWVYHIGENMVFDSDLHLLMVEERRLKAVGSLNWNKACYVPTKADAMVVAFRRWL NTYGGTQVDWRNQETAVAPPPPIPSREQLFDRYWTHTVNC
Physicochemical properties
Number of amino acids:		160
Molecular weight:		17,880.135
Theoretical pI:		7.417
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		19480 19480
Instability index:		51.896
aromaticity		0.031
GRAVY		-0.507
Secondary Structure Fraction
Helix		0.281
turn		0.250
sheet		0.250

Acc_NO	ORF type	length	start-end position (strand +/-)
>AW254899.1	internal	160	480-1(-)
Amino Acid sequence :
AIDRMSPVPVEELLSGRDRWWWRNGGLLIAPIHLRSSVRVEPPPEGHHHGIRLGGDVASLVPVEGPHSLEPPLLHHQKMEIRVKHHVLSDVVNPPRDDLIHPRREVPREREYQPALVRAH RNAQEYQHGLLSTGTTVGIGGGVEARCDELVRTAAVTTTK
Physicochemical properties
Number of amino acids:		160
Molecular weight:		17,880.135
Theoretical pI:		7.417
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		19480 19480
Instability index:		51.896
aromaticity		0.031
GRAVY		-0.507
Secondary Structure Fraction
Helix		0.281
turn		0.250
sheet		0.250