Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW254900.1 | internal | 174 | 3-524(+) |
Amino Acid sequence : | |||
RLLHLQQQLRKPPSAMEAAALFRAVKPFNFKLLKPTSLRFSSVSSSPTVHRGKLEKAYDGLLLDAGGTLLQLAKPVEEIYSAIGRKYGVETTAFDIKQGFKRAFSAPWPHKLRYQGDGKP FWKLVVSEATGCDNLDYFEEVYEYYAKGDAWKLPEGAHETMLCLKDSGVKLAVV | |||
Physicochemical properties | |||
Number of amino acids: | 174 | ||
Molecular weight: | 14,572.716 | ||
Theoretical pI: | 10.052 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12740 | ||
Instability index: | 33.278 | ||
aromaticity | 0.132 | ||
GRAVY | 0.152 | ||
Secondary Structure Fraction | |||
Helix | 0.380 | ||
turn | 0.248 | ||
sheet | 0.163 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW254900.1 | 5prime_partial | 129 | 524-135(-) |
Amino Acid sequence : | |||
DDSEFNSGIFQTQHCLVSSFRKLPCIAFGIVLVNFFKVIKIVAASSFRHHKFPKWLSITLVSKFVRPWGRESSFETLLYIKCSGLHTIFSADGGVNFFNRLRQLQQCAAGVQQQSVVRLL QFSSVNGGR* | |||
Physicochemical properties | |||
Number of amino acids: | 129 | ||
Molecular weight: | 14,572.716 | ||
Theoretical pI: | 10.052 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12740 | ||
Instability index: | 33.278 | ||
aromaticity | 0.132 | ||
GRAVY | 0.152 | ||
Secondary Structure Fraction | |||
Helix | 0.380 | ||
turn | 0.248 | ||
sheet | 0.163 |