| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW254900.1 | internal | 174 | 3-524(+) |
Amino Acid sequence : | |||
| RLLHLQQQLRKPPSAMEAAALFRAVKPFNFKLLKPTSLRFSSVSSSPTVHRGKLEKAYDGLLLDAGGTLLQLAKPVEEIYSAIGRKYGVETTAFDIKQGFKRAFSAPWPHKLRYQGDGKP FWKLVVSEATGCDNLDYFEEVYEYYAKGDAWKLPEGAHETMLCLKDSGVKLAVV | |||
Physicochemical properties | |||
| Number of amino acids: | 174 | ||
| Molecular weight: | 14,572.716 | ||
| Theoretical pI: | 10.052 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12740 | ||
| Instability index: | 33.278 | ||
| aromaticity | 0.132 | ||
| GRAVY | 0.152 | ||
Secondary Structure Fraction | |||
| Helix | 0.380 | ||
| turn | 0.248 | ||
| sheet | 0.163 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW254900.1 | 5prime_partial | 129 | 524-135(-) |
Amino Acid sequence : | |||
| DDSEFNSGIFQTQHCLVSSFRKLPCIAFGIVLVNFFKVIKIVAASSFRHHKFPKWLSITLVSKFVRPWGRESSFETLLYIKCSGLHTIFSADGGVNFFNRLRQLQQCAAGVQQQSVVRLL QFSSVNGGR* | |||
Physicochemical properties | |||
| Number of amino acids: | 129 | ||
| Molecular weight: | 14,572.716 | ||
| Theoretical pI: | 10.052 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12740 | ||
| Instability index: | 33.278 | ||
| aromaticity | 0.132 | ||
| GRAVY | 0.152 | ||
Secondary Structure Fraction | |||
| Helix | 0.380 | ||
| turn | 0.248 | ||
| sheet | 0.163 | ||