| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW254902.1 | 5prime_partial | 144 | 2-436(+) |
Amino Acid sequence : | |||
| EAGFAGIGVGAAYYGLRPVIEFMTFNFSMQAIDHIINSAAKSNYMSSGQISVPIVFRGPNGAAAGVCAQHSQCYAAWFGSCPGLKVLTPYSSEDAPGLLKAAIKDPDPVVFLENELLYGE SFPVSAECLNSHFCPPIGKAPIPP* | |||
Physicochemical properties | |||
| Number of amino acids: | 144 | ||
| Molecular weight: | 15,157.181 | ||
| Theoretical pI: | 5.175 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14440 14690 | ||
| Instability index: | 44.593 | ||
| aromaticity | 0.111 | ||
| GRAVY | 0.227 | ||
Secondary Structure Fraction | |||
| Helix | 0.306 | ||
| turn | 0.326 | ||
| sheet | 0.257 | ||