Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW254902.1 | 5prime_partial | 144 | 2-436(+) |
Amino Acid sequence : | |||
EAGFAGIGVGAAYYGLRPVIEFMTFNFSMQAIDHIINSAAKSNYMSSGQISVPIVFRGPNGAAAGVCAQHSQCYAAWFGSCPGLKVLTPYSSEDAPGLLKAAIKDPDPVVFLENELLYGE SFPVSAECLNSHFCPPIGKAPIPP* | |||
Physicochemical properties | |||
Number of amino acids: | 144 | ||
Molecular weight: | 15,157.181 | ||
Theoretical pI: | 5.175 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14440 14690 | ||
Instability index: | 44.593 | ||
aromaticity | 0.111 | ||
GRAVY | 0.227 | ||
Secondary Structure Fraction | |||
Helix | 0.306 | ||
turn | 0.326 | ||
sheet | 0.257 |