Acc_NO	ORF type	length	start-end position (strand +/-)
>AW254908.1	internal	203	2-610(+)
Amino Acid sequence :
ANVQRYALVTGANKGIGFEICRQLAEKGIIVILTARNEKRGIEAHQRLLKELNISKNHLVFHQLDVTDPASIAAVAVFIKSTFGKLDILVNNAGVSGVEMVGDVSVFNEYIEADFNALQA LEAGAKEEPPFKPKANGEMIEKFQGAKDCVQTNYYGPKRLTQALIPLLHYLLPRKSQRLLPFRSLLLLWNHGQRECLGDKIAT
Physicochemical properties
Number of amino acids:		203
Molecular weight:		22,522.843
Theoretical pI:		8.948
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		12950 13075
Instability index:		34.698
aromaticity		0.074
GRAVY		-0.086
Secondary Structure Fraction
Helix		0.335
turn		0.207
sheet		0.300