Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW254919.1 | 3prime_partial | 192 | 55-630(+) |
Amino Acid sequence : | |||
MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLEKVAADLRASIWKQMTDAGIKYIPSNTFSYYDQVLDTTAMLGAVPPRYNWTGGEIGFSTYFSMARGNASVPAMEMTKWFDTNYHFI VPELGPDVNFSYASHKAVHEYKEAKALGVDTVPVLVGPVSYLLLSQPAKGIEKLSTSVSSDKILHLQGIISN | |||
Physicochemical properties | |||
Number of amino acids: | 192 | ||
Molecular weight: | 17,246.544 | ||
Theoretical pI: | 8.916 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11375 | ||
Instability index: | 38.403 | ||
aromaticity | 0.045 | ||
GRAVY | -0.154 | ||
Secondary Structure Fraction | |||
Helix | 0.293 | ||
turn | 0.287 | ||
sheet | 0.204 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW254919.1 | 3prime_partial | 157 | 471-1(-) |
Amino Acid sequence : | |||
MDSFVRSIRKVHIRTQFRDNEMVVGIKPLGHLHSWNRGITSGHGEVSGEANLTTSPVVSRRNGTEHCSCVEHLIIVRECVAGNVLDPSISHLLPDGCSKISCHLLQILGAALAIPERFQS ELQLSLGAHTGVSNNVGCHFSLRTKGHWFPGRIGRER | |||
Physicochemical properties | |||
Number of amino acids: | 157 | ||
Molecular weight: | 17,246.544 | ||
Theoretical pI: | 8.916 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11375 | ||
Instability index: | 38.403 | ||
aromaticity | 0.045 | ||
GRAVY | -0.154 | ||
Secondary Structure Fraction | |||
Helix | 0.293 | ||
turn | 0.287 | ||
sheet | 0.204 |