| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW254922.1 | 5prime_partial | 200 | 3-605(+) |
Amino Acid sequence : | |||
| ATRWWKKLDVANKMPYARDRNVECFFWMVGVYFEPCYATARKILLKCISMASIIDDTYEYATLHELQILTDAIQRWDVNEALEDSPPYIQMCYRSLIQTYVEIEDEVVEKFGGESSYRVQ YAIQDMKKSVWAYMEEAKWMYDDYIPTVEEYMKVSIVSCGYMTMSTTSLMGMGIDQVCKENFDWIVNEPLLVRASPQFVD* | |||
Physicochemical properties | |||
| Number of amino acids: | 200 | ||
| Molecular weight: | 14,032.302 | ||
| Theoretical pI: | 10.240 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 19940 | ||
| Instability index: | 57.004 | ||
| aromaticity | 0.111 | ||
| GRAVY | -0.447 | ||
Secondary Structure Fraction | |||
| Helix | 0.368 | ||
| turn | 0.256 | ||
| sheet | 0.239 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW254922.1 | 5prime_partial | 117 | 642-289(-) |
Amino Acid sequence : | |||
| EFLVKLSRNRLSVNRQIAEKLEPREVHLRSNRNFLCKLDRSPYPLKKWWTLSYNHKIRSKPSYTPPRLEYNRHTSISPLPYMPTPIFSYLVLHIGHGMTILLQISPLLHLLFQHKFE* | |||
Physicochemical properties | |||
| Number of amino acids: | 117 | ||
| Molecular weight: | 14,032.302 | ||
| Theoretical pI: | 10.240 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 19940 | ||
| Instability index: | 57.004 | ||
| aromaticity | 0.111 | ||
| GRAVY | -0.447 | ||
Secondary Structure Fraction | |||
| Helix | 0.368 | ||
| turn | 0.256 | ||
| sheet | 0.239 | ||