Acc_NO	ORF type	length	start-end position (strand +/-)
>AW254939.1	internal	114	3-344(+)
Amino Acid sequence :
SMNCIYPSDLLPFTRRPLFLIVDGDNSKAFKVMSGAEKGEPAAILLSPVTPLPTVESSKQPSGSLFTSFLTSPLQTFTLLVGFTGSDVDKDLYNRGEKLLQSSLNKFGSLLAAS
Physicochemical properties
Number of amino acids:		114
Molecular weight:		12,230.907
Theoretical pI:		6.121
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		2980 2980
Instability index:		53.064
aromaticity		0.088
GRAVY		0.068
Secondary Structure Fraction
Helix		0.325
turn		0.325
sheet		0.263