Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW254942.1 | 3prime_partial | 108 | 38-361(+) |
Amino Acid sequence : | |||
MAALQYLDSLRNAHPELSEWYTTLSDLYQRKLWHQLTLKLEQFVTLAVFQAGDSLIQLYQNFITDFETKINLLKLAHFAVIVSRQYSEKDAAISYLEGVIEKLRNTSK | |||
Physicochemical properties | |||
Number of amino acids: | 108 | ||
Molecular weight: | 12,597.287 | ||
Theoretical pI: | 6.267 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 19940 | ||
Instability index: | 25.444 | ||
aromaticity | 0.120 | ||
GRAVY | -0.127 | ||
Secondary Structure Fraction | |||
Helix | 0.389 | ||
turn | 0.139 | ||
sheet | 0.324 |