| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW254942.1 | 3prime_partial | 108 | 38-361(+) |
Amino Acid sequence : | |||
| MAALQYLDSLRNAHPELSEWYTTLSDLYQRKLWHQLTLKLEQFVTLAVFQAGDSLIQLYQNFITDFETKINLLKLAHFAVIVSRQYSEKDAAISYLEGVIEKLRNTSK | |||
Physicochemical properties | |||
| Number of amino acids: | 108 | ||
| Molecular weight: | 12,597.287 | ||
| Theoretical pI: | 6.267 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 19940 | ||
| Instability index: | 25.444 | ||
| aromaticity | 0.120 | ||
| GRAVY | -0.127 | ||
Secondary Structure Fraction | |||
| Helix | 0.389 | ||
| turn | 0.139 | ||
| sheet | 0.324 | ||