Acc_NO	ORF type	length	start-end position (strand +/-)
>AW254943.1	5prime_partial	124	376-2(-)
Amino Acid sequence :
IXFSISQCDKITLPFIXHIWTLFTYLXCHLLKHPRTNLLVINLISTVTAPLSRXWFDYVFHPPDLQGTPHIQVFKCRIQINNDIITFDNPLFLFHGTSPEKRAKDILNIHTATSSPATTS CMLL*
Physicochemical properties
Number of amino acids:		124
Molecular weight:		13,059.657
Theoretical pI:		5.673
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		11460 11710
Instability index:		46.608
aromaticity		0.085
GRAVY		-0.474
Secondary Structure Fraction
Helix		0.280
turn		0.263
sheet		0.186

Acc_NO	ORF type	length	start-end position (strand +/-)
>AW254943.1	5prime_partial	121	2-367(+)
Amino Acid sequence :
LKQHAASGGRGGGGGVNIQDIFSSFFGGGSMEEEERVVKGDDVIVDLDATLEDLYMGGTLKVWRVKNVIKPXPGKRRCNCRNEVYHKQIGPGMFQQMTXQVCEQCPNVXYEREGDFITLG Y*
Physicochemical properties
Number of amino acids:		121
Molecular weight:		13,059.657
Theoretical pI:		5.673
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		11460 11710
Instability index:		46.608
aromaticity		0.085
GRAVY		-0.474
Secondary Structure Fraction
Helix		0.280
turn		0.263
sheet		0.186