| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW254946.1 | 3prime_partial | 182 | 29-574(+) |
Amino Acid sequence : | |||
| MVMNKQIVLNNYINGSLKQSDLALRTSTICMEIPNGCNGAILVKNLYLSVNPYLILRMGKLDIPQFDSILPGSTIVSYGVSKVLDSTHPSYEKGELIWGSQAGWEEYTLIQNPYNLFKIQ DKDVPLSYYVGILGMPGMTTYAGFFEICPPKKGETVFVTAAQDLWATLLVSLQKFWVYVVGS | |||
Physicochemical properties | |||
| Number of amino acids: | 182 | ||
| Molecular weight: | 20,274.352 | ||
| Theoretical pI: | 5.780 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 38390 38515 | ||
| Instability index: | 32.514 | ||
| aromaticity | 0.115 | ||
| GRAVY | 0.159 | ||
Secondary Structure Fraction | |||
| Helix | 0.390 | ||
| turn | 0.269 | ||
| sheet | 0.225 | ||