Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW254946.1 | 3prime_partial | 182 | 29-574(+) |
Amino Acid sequence : | |||
MVMNKQIVLNNYINGSLKQSDLALRTSTICMEIPNGCNGAILVKNLYLSVNPYLILRMGKLDIPQFDSILPGSTIVSYGVSKVLDSTHPSYEKGELIWGSQAGWEEYTLIQNPYNLFKIQ DKDVPLSYYVGILGMPGMTTYAGFFEICPPKKGETVFVTAAQDLWATLLVSLQKFWVYVVGS | |||
Physicochemical properties | |||
Number of amino acids: | 182 | ||
Molecular weight: | 20,274.352 | ||
Theoretical pI: | 5.780 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 38390 38515 | ||
Instability index: | 32.514 | ||
aromaticity | 0.115 | ||
GRAVY | 0.159 | ||
Secondary Structure Fraction | |||
Helix | 0.390 | ||
turn | 0.269 | ||
sheet | 0.225 |