Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW254948.1 | 5prime_partial | 178 | 608-72(-) |
Amino Acid sequence : | |||
PNSSGVPDNVPERRPADDGEVSVLSFPLSSTPAPPEERSGGGGRHFVLPDEAEGADVAGGEELGDADLAHLAPVLAVGAEDDVFVVVPHDPRPDALEPVRARRVYQLHRLLRRLPRRKDD GEHLTQLHVGHGAVLLRHAGQRVLRQLPPQEVEVPDQRQLRRARGELPLGFRFSPLVD* | |||
Physicochemical properties | |||
Number of amino acids: | 178 | ||
Molecular weight: | 11,415.897 | ||
Theoretical pI: | 9.682 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 24980 25230 | ||
Instability index: | 58.953 | ||
aromaticity | 0.146 | ||
GRAVY | -0.072 | ||
Secondary Structure Fraction | |||
Helix | 0.262 | ||
turn | 0.340 | ||
sheet | 0.194 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW254948.1 | 5prime_partial | 174 | 3-527(+) |
Amino Acid sequence : | |||
EIMELLQLWSALIILVVTYTISLLINQWRKPKPQGKFPPGPPKLPLIGHLHLLWGKLPQHALASVAKEYGPVAHVQLGEVFSVVLSSREATKEAMKLVDPACANRFESIGTRIMWYDNED IIFSPYSEHWRQMRKICVSELLSSRNVRSFGFIRQDEVSASSATPLLGRGGRGT* | |||
Physicochemical properties | |||
Number of amino acids: | 174 | ||
Molecular weight: | 11,415.897 | ||
Theoretical pI: | 9.682 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 24980 25230 | ||
Instability index: | 58.953 | ||
aromaticity | 0.146 | ||
GRAVY | -0.072 | ||
Secondary Structure Fraction | |||
Helix | 0.262 | ||
turn | 0.340 | ||
sheet | 0.194 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW254948.1 | complete | 103 | 367-56(-) |
Amino Acid sequence : | |||
MMSSLSYHMILVPMLSNRFAHAGSTSFIASFVASRDERTTENTSPSCTWATGPYSFATLASACCGSFPHRRWRCPISGSFGGPGGNFPWGFGFRHWLIRRDMV* | |||
Physicochemical properties | |||
Number of amino acids: | 103 | ||
Molecular weight: | 11,415.897 | ||
Theoretical pI: | 9.682 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 24980 25230 | ||
Instability index: | 58.953 | ||
aromaticity | 0.146 | ||
GRAVY | -0.072 | ||
Secondary Structure Fraction | |||
Helix | 0.262 | ||
turn | 0.340 | ||
sheet | 0.194 |