Acc_NO	ORF type	length	start-end position (strand +/-)
>AW254952.1	internal	168	2-505(+)
Amino Acid sequence :
TLPSIVRVLYVFSIYSISSELQESAKMVKNYPVVSEEYLKAVDKCKRKLRGLIAEKNCAPIMLRLAWHSAGTFDQCSKTGGPFGTMRFEAELAHGANNGLDIALRLLEPIRKQFPTISFA DFYHLAGVVAVEVTGRPDVPFHHEGGQGKPLLKAACHNATKGSDLLRD
Physicochemical properties
Number of amino acids:		168
Molecular weight:		18,500.195
Theoretical pI:		8.897
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		12950 13200
Instability index:		41.086
aromaticity		0.083
GRAVY		-0.098
Secondary Structure Fraction
Helix		0.310
turn		0.226
sheet		0.280