Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW254962.1 | internal | 177 | 3-533(+) |
Amino Acid sequence : | |||
EIEVDMVMNKQIVFNNYINGSLKQSDLALRTSTICMEIPDGCNGAILVKNLYLSVNPYLILRMGKLDIPQFDSILPGSTIVSYGVSKVLDSTHPSYEKGELIWGSQAGWEEYTLIQNPYN LFKIQDKDVPLSYYVGILGMPGMTAYAGFFEICSPKKGETVFVTAAPGSVGHLVGHL | |||
Physicochemical properties | |||
Number of amino acids: | 177 | ||
Molecular weight: | 19,474.268 | ||
Theoretical pI: | 5.095 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 25900 26025 | ||
Instability index: | 34.697 | ||
aromaticity | 0.102 | ||
GRAVY | 0.107 | ||
Secondary Structure Fraction | |||
Helix | 0.367 | ||
turn | 0.282 | ||
sheet | 0.226 |