Acc_NO	ORF type	length	start-end position (strand +/-)
>AW254983.1	internal	164	3-494(+)
Amino Acid sequence :
EWQHEKSTSSKKNEWSFAREDINENGCLSIIVLGASGDLAKKKTFPALFNLYQQGFLQLNDVHIFGYSRTKLSDDELRERIRGYLPMAMGMGRESSGSATVSEFLHLIKYMSGGYDSPEG FQELDKAITEHEISKKNRQGSCRRLFYLALPPSVYIQVCKMIKK
Physicochemical properties
Number of amino acids:		164
Molecular weight:		18,709.153
Theoretical pI:		8.723
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		21430 21555
Instability index:		50.584
aromaticity		0.104
GRAVY		-0.512
Secondary Structure Fraction
Helix		0.293
turn		0.250
sheet		0.256