Acc_NO	ORF type	length	start-end position (strand +/-)
>AW254986.1	internal	123	1-369(+)
Amino Acid sequence :
PTSVKIKLIRKLVFAGLPVVEATSFVSPKWVPQLADAKDVMEAVKNLEGVRLPVLTPNLKGFEAAVAAGAKEVSIFASASESFSKSNINCSIEESLARYRAVTSSAKKLSIPVRGYVSCV LGC
Physicochemical properties
Number of amino acids:		123
Molecular weight:		13,054.149
Theoretical pI:		9.448
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		8480 8605
Instability index:		30.650
aromaticity		0.065
GRAVY		0.298
Secondary Structure Fraction
Helix		0.333
turn		0.260
sheet		0.285