Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW254996.1 | 5prime_partial | 165 | 3-500(+) |
Amino Acid sequence : | |||
QFVENPKMEELEQLLPTDFSSHTDNPILSVRTSYFDCEGIAVGICFPHKMGDTSTFAMFMNAWAATCRGEASRIIPPSFELALRFPPREFLASEFYLGSSGDKIVTRKLVFEREKVEKIR KEASRNHEVKDPSRVEAVSSVLWRSFIEAHKKVEKEATRFLPPIW* | |||
Physicochemical properties | |||
Number of amino acids: | 165 | ||
Molecular weight: | 18,942.483 | ||
Theoretical pI: | 6.502 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19605 | ||
Instability index: | 40.402 | ||
aromaticity | 0.109 | ||
GRAVY | -0.339 | ||
Secondary Structure Fraction | |||
Helix | 0.297 | ||
turn | 0.218 | ||
sheet | 0.273 |