Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW254999.1 | 5prime_partial | 151 | 1-456(+) |
Amino Acid sequence : | |||
EKVKMVADEEVRVRAEAWNNAFGYIKPTAVATAVELGLPDILENHDGPMSLLELSAATDCPAEPLHRLMRFLVFHGIFKKTAKPPLSNEAVYYARTALSRLFTKDELGDFMLLQTGPLSQ HPAGLTASSLRTGKPQFIRSVNGKGLLDRPG* | |||
Physicochemical properties | |||
Number of amino acids: | 151 | ||
Molecular weight: | 16,558.913 | ||
Theoretical pI: | 8.149 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 9970 | ||
Instability index: | 28.340 | ||
aromaticity | 0.073 | ||
GRAVY | -0.166 | ||
Secondary Structure Fraction | |||
Helix | 0.291 | ||
turn | 0.232 | ||
sheet | 0.331 |