Acc_NO	ORF type	length	start-end position (strand +/-)
>AW255000.1	internal	129	3-389(+)
Amino Acid sequence :
KFGKLDILVNNAGVSGVQMVGDVSVFNEYIEADFKALQALEAGAKEEPPFKPKANGEMIEKFEGAKDCVVTNYYGPKRLTQALIPLLQLSPSPRIVNVSSSFGSLLLLWNEWAKGVLCDE HRLTEERVD
Physicochemical properties
Number of amino acids:		129
Molecular weight:		14,240.160
Theoretical pI:		5.064
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		15470 15595
Instability index:		34.317
aromaticity		0.085
GRAVY		-0.136
Secondary Structure Fraction
Helix		0.333
turn		0.248
sheet		0.302