| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255012.1 | 3prime_partial | 113 | 25-363(+) |
Amino Acid sequence : | |||
| MELQFSSAIIILVISYTIYLLIIKQWRKSKPQENLPPGPPKLPLIGHLHLLWGKLPQHALGSVAKQYGPVAHVQLGEVFSVVLSSREATNEAMKLVDPACADRFESIGTKIMW | |||
Physicochemical properties | |||
| Number of amino acids: | 113 | ||
| Molecular weight: | 12,599.763 | ||
| Theoretical pI: | 9.167 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20970 20970 | ||
| Instability index: | 33.352 | ||
| aromaticity | 0.080 | ||
| GRAVY | 0.177 | ||
Secondary Structure Fraction | |||
| Helix | 0.372 | ||
| turn | 0.239 | ||
| sheet | 0.283 | ||