Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW255012.1 | 3prime_partial | 113 | 25-363(+) |
Amino Acid sequence : | |||
MELQFSSAIIILVISYTIYLLIIKQWRKSKPQENLPPGPPKLPLIGHLHLLWGKLPQHALGSVAKQYGPVAHVQLGEVFSVVLSSREATNEAMKLVDPACADRFESIGTKIMW | |||
Physicochemical properties | |||
Number of amino acids: | 113 | ||
Molecular weight: | 12,599.763 | ||
Theoretical pI: | 9.167 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20970 20970 | ||
Instability index: | 33.352 | ||
aromaticity | 0.080 | ||
GRAVY | 0.177 | ||
Secondary Structure Fraction | |||
Helix | 0.372 | ||
turn | 0.239 | ||
sheet | 0.283 |