| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255023.1 | 5prime_partial | 170 | 1-513(+) |
Amino Acid sequence : | |||
| QXFTLTTYTADGVAITSTGIKKGDAFLADVNSQLKSKNLTTDVKVDTNSNVYTTFTLDEPAPGVKAIFSFVAPDQKSGKVELQYLHEYAGISTSLGLTAKPIVNFSGVAGNHNATFGTDV SFDTASGNFTKYNAAISYTTADLIASLMLNDKGETIKASYFHTVSPLSTQ* | |||
Physicochemical properties | |||
| Number of amino acids: | 170 | ||
| Molecular weight: | 17,939.761 | ||
| Theoretical pI: | 5.486 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 10430 10430 | ||
| Instability index: | 4.863 | ||
| aromaticity | 0.101 | ||
| GRAVY | -0.094 | ||
Secondary Structure Fraction | |||
| Helix | 0.296 | ||
| turn | 0.254 | ||
| sheet | 0.207 | ||