| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255029.1 | internal | 119 | 1-357(+) |
Amino Acid sequence : | |||
| LLQISKVLVVGKDFGAKVVYQFALLHPQRVVALATLGLPFLIPGPVDVPKGFYLPRWKEPGRAERDFGRFHVKTVIKKIYIMFTDSELQVASDDQEIMDLVDESAPLPAWFIEEDLYAY | |||
Physicochemical properties | |||
| Number of amino acids: | 119 | ||
| Molecular weight: | 13,536.630 | ||
| Theoretical pI: | 5.303 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18450 18450 | ||
| Instability index: | 44.504 | ||
| aromaticity | 0.126 | ||
| GRAVY | 0.145 | ||
Secondary Structure Fraction | |||
| Helix | 0.412 | ||
| turn | 0.168 | ||
| sheet | 0.269 | ||